PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1156_p6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 453aa    MW: 51492.2 Da    PI: 6.5236
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1156_p6genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.85e-103123491954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  RrC1156_p6 312 FEHflHPYPKESEKVMLAKQTGLSKNQVANWFINARVR 349
                 554459******************************88 PP

2BELL113.11.5e-36169240172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 erqelq+kk+kLl+l++eVdkrY+qy++q+++++ssFe+vag gsakpYts+Al++iS hFr+L+da++eq+
  RrC1156_p6 169 ERQELQSKKNKLLTLVDEVDKRYNQYYHQMEALASSFEIVAGFGSAKPYTSVALNRISSHFRSLRDAMKEQV 240
                 79*******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.3E-43114238IPR006563POX domain
PfamPF075267.1E-42119236IPR006563POX domain
PROSITE profilePS5007112.519290353IPR001356Homeobox domain
SMARTSM003891.2E-9293357IPR001356Homeobox domain
CDDcd000862.26E-11293354No hitNo description
SuperFamilySSF466891.58E-17294361IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27296359IPR009057Homeodomain-like
PfamPF059209.4E-18310349IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MVFIPPTTTI GGGDVAVVTA LPQNLNGDDV PVSSSEPTFR DGRGLSLSLS TQILDYHHQY  60
QPGLTPNPSI SVKETPPFSR EMLLLGQSDP SSTGFAGFYN GYRYNETSSG GGFMNMSSVL  120
RSRYLKPAQS LLDEVVSVKK EVNNMRKKKK GEDFNNDSNG ISIELSTTER QELQSKKNKL  180
LTLVDEVDKR YNQYYHQMEA LASSFEIVAG FGSAKPYTSV ALNRISSHFR SLRDAMKEQV  240
QMMGEKLGEK GGDLSLDEQQ QGGERIPRLR YLDQRLRQQR ALHQQFGMVR PSWRPQRGLP  300
ESSVSALRAW LFEHFLHPYP KESEKVMLAK QTGLSKNQVA NWFINARVRL WKPMIEEMYK  360
EEFEPNITTN QEDSSSQQQE NNNNNNNNND LTYSSAEPKP NRTSGNEDDP PQQQQMNRSA  420
DYDSLMNYHG FGLDDYHQQD SRFSNGHHLH DFV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A9e-16299357563Homeobox protein Meis2
3k2a_B9e-16299357563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3526000.0AK352600.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-03-C02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013729468.10.0PREDICTED: BEL1-like homeodomain protein 10 isoform X2
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLE4MVQ30.0E4MVQ3_EUTHA; mRNA, clone: RTFL01-03-C02
TrEMBLV4MSR40.0V4MSR4_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.1__2150__AT1G19700.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10